PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000777336
Common NameGATA3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 324aa    MW: 35496.8 Da    PI: 6.1795
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000777336genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.58.8e-19242275134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  MDP0000777336 242 CSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGR 275
                    *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.6E-835319IPR016679Transcription factor, GATA, plant
SMARTSM004013.3E-14236290IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-14238299No hitNo description
PROSITE profilePS5011411.174240272IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.1E-14240273IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.40E-14241290No hitNo description
PfamPF003201.7E-16242275IPR000679Zinc finger, GATA-type
PROSITE patternPS003440242267IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MEYCMEARAL KSSLRRELAV KSTQHVLLEE LWCATGISGV PSEDFSVDDL LDLSNDEFGN  60
GSVEEEGEER DSVSVDDETS NSSNSVLADS DSGLATQLVV PDDDLAELEW VSHFVDDSLP  120
DLSLLHTIGV QKPEALLANR SESEPKPAQL RASLFPFEVP VKPRTKRCRL ASRDWSLSSS  180
SSPSSPSSSS GSGLSFSTPC LIFNPVQSMH VFVGEPAAKK QKKKPAVQTG EGSIGGQFQR  240
RCSHCQVQKT PQWRTGPLGP KTLCNACGVR FKSGRLFPEY RPACSPTFSG DVHSNSHRKV  300
LEMRKRKEVG EPEPRLNRMI RSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.8720.0bud| cell culture| fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280850.11e-175GATA transcription factor 5-like
TrEMBLD9ZIZ00.0D9ZIZ0_MALDO; GATA domain class transcription factor
STRINGPOPTR_0004s16860.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.24e-59GATA transcription factor 5